Brand: | Abnova |
Reference: | H00080270-A01 |
Product name: | HSD3B7 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant HSD3B7. |
Gene id: | 80270 |
Gene name: | HSD3B7 |
Gene alias: | PFIC4|SDR11E3 |
Gene description: | hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 |
Genbank accession: | NM_025193 |
Immunogen: | HSD3B7 (NP_079469, 101 a.a. ~ 209 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | IHEVNVQGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHRHPYPCSKALAEWLVLEANGRKVRGGLPLVTCALRPTGIYGEGHQIMRDFYRQG |
Protein accession: | NP_079469 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |