Brand: | Abnova |
Reference: | H00080207-M03A |
Product name: | OPA3 monoclonal antibody (M03A), clone 1B8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant OPA3. |
Clone: | 1B8 |
Isotype: | IgG1 Kappa |
Gene id: | 80207 |
Gene name: | OPA3 |
Gene alias: | FLJ22187|FLJ25932|MGA3|MGC75494 |
Gene description: | optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia) |
Genbank accession: | NM_025136 |
Immunogen: | OPA3 (NP_079412.1, 103 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQTQVQAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK |
Protein accession: | NP_079412.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |