OPA3 monoclonal antibody (M03A), clone 1B8 View larger

OPA3 monoclonal antibody (M03A), clone 1B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OPA3 monoclonal antibody (M03A), clone 1B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about OPA3 monoclonal antibody (M03A), clone 1B8

Brand: Abnova
Reference: H00080207-M03A
Product name: OPA3 monoclonal antibody (M03A), clone 1B8
Product description: Mouse monoclonal antibody raised against a partial recombinant OPA3.
Clone: 1B8
Isotype: IgG1 Kappa
Gene id: 80207
Gene name: OPA3
Gene alias: FLJ22187|FLJ25932|MGA3|MGC75494
Gene description: optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia)
Genbank accession: NM_025136
Immunogen: OPA3 (NP_079412.1, 103 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQTQVQAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK
Protein accession: NP_079412.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080207-M03A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy OPA3 monoclonal antibody (M03A), clone 1B8 now

Add to cart