Brand: | Abnova |
Reference: | H00080204-M02 |
Product name: | FBXO11 monoclonal antibody (M02), clone 1A2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FBXO11. |
Clone: | 1A2 |
Isotype: | IgG2a Kappa |
Gene id: | 80204 |
Gene name: | FBXO11 |
Gene alias: | FBX11|FLJ12673|MGC44383|PRMT9|UBR6|UG063H01|VIT1 |
Gene description: | F-box protein 11 |
Genbank accession: | NM_025133 |
Immunogen: | FBXO11 (NP_079409, 744 a.a. ~ 843 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KAVSRGQCLYKISSYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN |
Protein accession: | NP_079409 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged FBXO11 is 0.1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |