FBXO11 monoclonal antibody (M01A), clone 4C12 View larger

FBXO11 monoclonal antibody (M01A), clone 4C12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXO11 monoclonal antibody (M01A), clone 4C12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about FBXO11 monoclonal antibody (M01A), clone 4C12

Brand: Abnova
Reference: H00080204-M01A
Product name: FBXO11 monoclonal antibody (M01A), clone 4C12
Product description: Mouse monoclonal antibody raised against a partial recombinant FBXO11.
Clone: 4C12
Isotype: IgG2a Kappa
Gene id: 80204
Gene name: FBXO11
Gene alias: FBX11|FLJ12673|MGC44383|PRMT9|UBR6|UG063H01|VIT1
Gene description: F-box protein 11
Genbank accession: NM_025133
Immunogen: FBXO11 (NP_079409, 744 a.a. ~ 843 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KAVSRGQCLYKISSYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN
Protein accession: NP_079409
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080204-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FBXO11 monoclonal antibody (M01A), clone 4C12 now

Add to cart