HKDC1 monoclonal antibody (M13), clone 4E8 View larger

HKDC1 monoclonal antibody (M13), clone 4E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HKDC1 monoclonal antibody (M13), clone 4E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about HKDC1 monoclonal antibody (M13), clone 4E8

Brand: Abnova
Reference: H00080201-M13
Product name: HKDC1 monoclonal antibody (M13), clone 4E8
Product description: Mouse monoclonal antibody raised against a partial recombinant HKDC1.
Clone: 4E8
Isotype: IgG2a Kappa
Gene id: 80201
Gene name: HKDC1
Gene alias: FLJ22761|FLJ37767|MGC125688
Gene description: hexokinase domain containing 1
Genbank accession: NM_025130
Immunogen: HKDC1 (NP_079406, 102 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KRHVQMESQFYPTPNEIIRGNGIELFEYVADCLADFMKTKDLKHKKLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGVQDTDVVSRLTKAMRRHKDMD
Protein accession: NP_079406
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080201-M13-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080201-M13-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to HKDC1 on HeLa cell . [antibody concentration 40 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HKDC1 monoclonal antibody (M13), clone 4E8 now

Add to cart