Cart 69 Product Products 27 745,58 € (empty)
No products
To be determined Shipping
27 745,58 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 69 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 27 745,58 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 27 745,58 €
Data sheet of TMEM134 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about TMEM134 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00080194-D01P |
| Product name: | TMEM134 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human TMEM134 protein. |
| Gene id: | 80194 |
| Gene name: | TMEM134 |
| Gene alias: | FLJ21749|MGC149891 |
| Gene description: | transmembrane protein 134 |
| Genbank accession: | NM_025124 |
| Immunogen: | TMEM134 (NP_079400.1, 1 a.a. ~ 195 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSAARPQFSIDDAFELSLEDGGPGPESSGVARFGPLHFERRARFEVADEDKQSRLRYQNLENDEDGAQASPEPDGGVGTRDSSRTSIRSSQWSFSTISSSTQRSYNTCCSWTQHPLIQKNRRVVLASFLLLLLGLVLILVGVGLEATPSPGVSSAIFFVPGFLLLVPGVYHVIFIYCAVKGHRGFQFFYLPYFEK |
| Protein accession: | NP_079400.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of TMEM134 expression in transfected 293T cell line (H00080194-T01) by TMEM134 MaxPab polyclonal antibody. Lane 1: TMEM134 transfected lysate(21.60 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |