Brand: | Abnova |
Reference: | H00080176-M02 |
Product name: | SPSB1 monoclonal antibody (M02), clone 3E7 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant SPSB1. |
Clone: | 3E7 |
Isotype: | IgG2a Kappa |
Gene id: | 80176 |
Gene name: | SPSB1 |
Gene alias: | SSB-1|SSB1 |
Gene description: | splA/ryanodine receptor domain and SOCS box containing 1 |
Genbank accession: | BC015711 |
Immunogen: | SPSB1 (AAH15711, 1 a.a. ~ 273 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDDKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ |
Protein accession: | AAH15711 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SPSB1 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |