SPSB1 monoclonal antibody (M02), clone 3E7 View larger

SPSB1 monoclonal antibody (M02), clone 3E7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPSB1 monoclonal antibody (M02), clone 3E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about SPSB1 monoclonal antibody (M02), clone 3E7

Brand: Abnova
Reference: H00080176-M02
Product name: SPSB1 monoclonal antibody (M02), clone 3E7
Product description: Mouse monoclonal antibody raised against a full-length recombinant SPSB1.
Clone: 3E7
Isotype: IgG2a Kappa
Gene id: 80176
Gene name: SPSB1
Gene alias: SSB-1|SSB1
Gene description: splA/ryanodine receptor domain and SOCS box containing 1
Genbank accession: BC015711
Immunogen: SPSB1 (AAH15711, 1 a.a. ~ 273 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDDKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ
Protein accession: AAH15711
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080176-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged SPSB1 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy SPSB1 monoclonal antibody (M02), clone 3E7 now

Add to cart