DBF4B monoclonal antibody (M01), clone 1A7 View larger

DBF4B monoclonal antibody (M01), clone 1A7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DBF4B monoclonal antibody (M01), clone 1A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about DBF4B monoclonal antibody (M01), clone 1A7

Brand: Abnova
Reference: H00080174-M01
Product name: DBF4B monoclonal antibody (M01), clone 1A7
Product description: Mouse monoclonal antibody raised against a partial recombinant DBF4B.
Clone: 1A7
Isotype: IgG1 Kappa
Gene id: 80174
Gene name: DBF4B
Gene alias: ASKL1|DRF1|FLJ13087|MGC15009|ZDBF1B|chifb
Gene description: DBF4 homolog B (S. cerevisiae)
Genbank accession: NM_145663
Immunogen: DBF4B (NP_663696, 201 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VKKQQPKKPEGTCPAAESRTRKVARLKAPFLKIEDESRKFRPFHHQFKSFPEISFLGPKDASPFEAPTTLGSMHHTRESKDGEPSPRSAAHTMPRRKKG
Protein accession: NP_663696
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080174-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080174-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged DBF4B is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DBF4B monoclonal antibody (M01), clone 1A7 now

Add to cart