Brand: | Abnova |
Reference: | H00080174-M01 |
Product name: | DBF4B monoclonal antibody (M01), clone 1A7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DBF4B. |
Clone: | 1A7 |
Isotype: | IgG1 Kappa |
Gene id: | 80174 |
Gene name: | DBF4B |
Gene alias: | ASKL1|DRF1|FLJ13087|MGC15009|ZDBF1B|chifb |
Gene description: | DBF4 homolog B (S. cerevisiae) |
Genbank accession: | NM_145663 |
Immunogen: | DBF4B (NP_663696, 201 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VKKQQPKKPEGTCPAAESRTRKVARLKAPFLKIEDESRKFRPFHHQFKSFPEISFLGPKDASPFEAPTTLGSMHHTRESKDGEPSPRSAAHTMPRRKKG |
Protein accession: | NP_663696 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged DBF4B is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |