DBF4B MaxPab mouse polyclonal antibody (B01) View larger

DBF4B MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DBF4B MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about DBF4B MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00080174-B01
Product name: DBF4B MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human DBF4B protein.
Gene id: 80174
Gene name: DBF4B
Gene alias: ASKL1|DRF1|FLJ13087|MGC15009|ZDBF1B|chifb
Gene description: DBF4 homolog B (S. cerevisiae)
Genbank accession: NM_025104.2
Immunogen: DBF4B (NP_079380.1, 1 a.a. ~ 170 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSEPGKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSGKSFYLDLPAGKNLQFLTGAIQQLGGVIEGFLSKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPSRKPVDSVPLSRGKELLQKAIRNQVSWGKMGQSRWSPA
Protein accession: NP_079380.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080174-B01-13-15-1.jpg
Application image note: Western Blot analysis of DBF4B expression in transfected 293T cell line (H00080174-T01) by DBF4B MaxPab polyclonal antibody.

Lane 1: DRF1 transfected lysate(18.7 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DBF4B MaxPab mouse polyclonal antibody (B01) now

Add to cart