MOGAT2 purified MaxPab mouse polyclonal antibody (B01P) View larger

MOGAT2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MOGAT2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about MOGAT2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00080168-B01P
Product name: MOGAT2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human MOGAT2 protein.
Gene id: 80168
Gene name: MOGAT2
Gene alias: DGAT2L5|FLJ22644|MGAT2|MGC119183|MGC119184|MGC119185
Gene description: monoacylglycerol O-acyltransferase 2
Genbank accession: BC103878.1
Immunogen: MOGAT2 (AAI03879.1, 1 a.a. ~ 284 a.a) full-length human protein.
Immunogen sequence/protein sequence: MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLDRDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFANLCTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNLLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGYQASGKSTLGSVGNWQGFYFGGKMAETNADSILVEIFSPFTIKIIFWCLMPKYLEKFPQRRLSDLRN
Protein accession: AAI03879.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080168-B01P-13-15-1.jpg
Application image note: Western Blot analysis of MOGAT2 expression in transfected 293T cell line (H00080168-T01) by MOGAT2 MaxPab polyclonal antibody.

Lane 1: MOGAT2 transfected lysate(31.24 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MOGAT2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart