NARG1 monoclonal antibody (M01), clone 4A11 View larger

NARG1 monoclonal antibody (M01), clone 4A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NARG1 monoclonal antibody (M01), clone 4A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NARG1 monoclonal antibody (M01), clone 4A11

Brand: Abnova
Reference: H00080155-M01
Product name: NARG1 monoclonal antibody (M01), clone 4A11
Product description: Mouse monoclonal antibody raised against a partial recombinant NARG1.
Clone: 4A11
Isotype: IgG2a Kappa
Gene id: 80155
Gene name: NARG1
Gene alias: Ga19|NATH|TBDN100
Gene description: NMDA receptor regulated 1
Genbank accession: NM_057175
Immunogen: NARG1 (NP_476516.1, 764 a.a. ~ 862 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HRLSAAKMVYYLDPSSQKRAIELATTLDESLTNRNLQTCMEVLEALYDGSLGDCKEAAEIYRANCHKLFPYALAFMPPGYEEDMKITVNGDSSAEAEEL
Protein accession: NP_476516.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080155-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080155-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged NARG1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NARG1 monoclonal antibody (M01), clone 4A11 now

Add to cart