View larger

ASRGL1 purified MaxPab rabbit polyclonal antibody (D01P)

Reference:

Condition: New product

Data sheet of ASRGL1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand:	Abnova
Reference:	H00080150-D01P
Product name:	ASRGL1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description:	Rabbit polyclonal antibody raised against a full-length human ASRGL1 protein.
Gene id:	80150
Gene name:	ASRGL1
Gene alias:	ALP\|ALP1\|FLJ22316
Gene description:	asparaginase like 1
Genbank accession:	BC093070.1
Immunogen:	ASRGL1 (NP_001077395.1, 1 a.a. ~ 308 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLNTNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPDDTTITDLP
Protein accession:	NP_001077395.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of ASRGL1 expression in transfected 293T cell line (H00080150-T01) by ASRGL1 MaxPab polyclonal antibody. Lane 1: ASRGL1 transfected lysate(32.10 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice