Brand: | Abnova |
Reference: | H00080122-M01 |
Product name: | YSK4 monoclonal antibody (M01), clone 2A4 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant YSK4. |
Clone: | 2A4 |
Isotype: | IgG2a Kappa |
Gene id: | 80122 |
Gene name: | YSK4 |
Gene alias: | FLJ23074|RCK |
Gene description: | YSK4 Sps1/Ste20-related kinase homolog (S. cerevisiae) |
Genbank accession: | BC034417 |
Immunogen: | YSK4 (AAH34417, 1 a.a. ~ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEFVPGGSISSIINRFGPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRLAWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAADFVRMCLTR |
Protein accession: | AAH34417 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged YSK4 is 1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |
Publications: | Furospinosulin-1, marine spongean furanosesterterpene, suppresses the growth of hypoxia-adapted cancer cells by binding to transcriptional regulators p54nrb and LEDGF/p75.Arai M, Kawachi T, Kotoku N, Nakata C, Kamada H, Tsunoda S, Tsutsumi Y, Endo H, Inoue M, Sato H, Kobayashi M. Chembiochem. 2016 Jan;17(2):181-9. doi: 10.1002/cbic.201500519. Epub 2015 Dec 9. |