YSK4 monoclonal antibody (M01), clone 2A4 View larger

YSK4 monoclonal antibody (M01), clone 2A4

H00080122-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of YSK4 monoclonal antibody (M01), clone 2A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about YSK4 monoclonal antibody (M01), clone 2A4

Brand: Abnova
Reference: H00080122-M01
Product name: YSK4 monoclonal antibody (M01), clone 2A4
Product description: Mouse monoclonal antibody raised against a full-length recombinant YSK4.
Clone: 2A4
Isotype: IgG2a Kappa
Gene id: 80122
Gene name: YSK4
Gene alias: FLJ23074|RCK
Gene description: YSK4 Sps1/Ste20-related kinase homolog (S. cerevisiae)
Genbank accession: BC034417
Immunogen: YSK4 (AAH34417, 1 a.a. ~ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEFVPGGSISSIINRFGPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRLAWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAADFVRMCLTR
Protein accession: AAH34417
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080122-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged YSK4 is 1 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA
Shipping condition: Dry Ice
Publications: Furospinosulin-1, marine spongean furanosesterterpene, suppresses the growth of hypoxia-adapted cancer cells by binding to transcriptional regulators p54nrb and LEDGF/p75.Arai M, Kawachi T, Kotoku N, Nakata C, Kamada H, Tsunoda S, Tsutsumi Y, Endo H, Inoue M, Sato H, Kobayashi M.
Chembiochem. 2016 Jan;17(2):181-9. doi: 10.1002/cbic.201500519. Epub 2015 Dec 9.

Reviews

Buy YSK4 monoclonal antibody (M01), clone 2A4 now

Add to cart