YSK4 purified MaxPab mouse polyclonal antibody (B01P) View larger

YSK4 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of YSK4 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about YSK4 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00080122-B01P
Product name: YSK4 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human YSK4 protein.
Gene id: 80122
Gene name: YSK4
Gene alias: FLJ23074|RCK
Gene description: YSK4 Sps1/Ste20-related kinase homolog (S. cerevisiae)
Genbank accession: BC034417.1
Immunogen: YSK4 (AAH34417.1, 1 a.a. ~ 168 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEFVPGGSISSIINRFGPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRLAWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAADFVRMCLTR
Protein accession: AAH34417.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080122-B01P-13-15-1.jpg
Application image note: Western Blot analysis of YSK4 expression in transfected 293T cell line (H00080122-T02) by YSK4 MaxPab polyclonal antibody.

Lane 1: YSK4 transfected lysate(18.48 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy YSK4 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart