TAIP-2 (Human) Recombinant Protein (Q01) View larger

TAIP-2 (Human) Recombinant Protein (Q01)

H00080034-Q01_10ug

New product

374,00 € tax excl.

10 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TAIP-2 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about TAIP-2 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00080034-Q01
Product name: TAIP-2 (Human) Recombinant Protein (Q01)
Product description: Human TAIP-2 partial ORF ( NP_079245, 476 a.a. - 585 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 80034
Gene name: CSRNP3
Gene alias: FAM130A2|FLJ11703|FLJ32093|FLJ44141|TAIP-2|TAIP2
Gene description: cysteine-serine-rich nuclear protein 3
Genbank accession: NM_024969
Immunogen sequence/protein sequence: QFVDYARQAEEAYGASHYPAANPSVIVCCSSSENDSGVPCNSLYPEHRSNHPQVEFHSYLKGPSQEGFVSALNGDSHISEHPAENSLSLAEKSILHEECIKSPVVETVPV
Protein accession: NP_079245
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00080034-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TAIP-2 (Human) Recombinant Protein (Q01) now

Add to cart