TAIP-2 polyclonal antibody (A01) View larger

TAIP-2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TAIP-2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TAIP-2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00080034-A01
Product name: TAIP-2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant TAIP-2.
Gene id: 80034
Gene name: CSRNP3
Gene alias: FAM130A2|FLJ11703|FLJ32093|FLJ44141|TAIP-2|TAIP2
Gene description: cysteine-serine-rich nuclear protein 3
Genbank accession: NM_024969
Immunogen: TAIP-2 (NP_079245, 476 a.a. ~ 585 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: QFVDYARQAEEAYGASHYPAANPSVIVCCSSSENDSGVPCNSLYPEHRSNHPQVEFHSYLKGPSQEGFVSALNGDSHISEHPAENSLSLAEKSILHEECIKSPVVETVPV
Protein accession: NP_079245
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080034-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TAIP-2 polyclonal antibody (A01) now

Add to cart