FBXL18 monoclonal antibody (M01), clone 3H5 View larger

FBXL18 monoclonal antibody (M01), clone 3H5

H00080028-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXL18 monoclonal antibody (M01), clone 3H5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about FBXL18 monoclonal antibody (M01), clone 3H5

Brand: Abnova
Reference: H00080028-M01
Product name: FBXL18 monoclonal antibody (M01), clone 3H5
Product description: Mouse monoclonal antibody raised against a partial recombinant FBXL18.
Clone: 3H5
Isotype: IgG1 Kappa
Gene id: 80028
Gene name: FBXL18
Gene alias: FLJ10776|FLJ11467|FLJ26934|FLJ38075|FLJ41541|Fbl18
Gene description: F-box and leucine-rich repeat protein 18
Genbank accession: NM_024963
Immunogen: FBXL18 (NP_079239, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MASSGEDISNDDDDMHPAAAGMADGVHLLGFSDEILLHILSHVPSTDLILNVRRTCRKLAALCLDKSLIHTVLLQKDYQASEDKVRQLVKEIGREIQQLSMAGCYWLPGS
Protein accession: NP_079239
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080028-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080028-M01-3-6-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to FBXL18 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FBXL18 monoclonal antibody (M01), clone 3H5 now

Add to cart