Brand: | Abnova |
Reference: | H00080025-M01 |
Product name: | PANK2 monoclonal antibody (M01), clone 2B12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PANK2. |
Clone: | 2B12 |
Isotype: | IgG2a Kappa |
Gene id: | 80025 |
Gene name: | PANK2 |
Gene alias: | C20orf48|FLJ17232|HARP|HSS|MGC15053|NBIA1|PKAN |
Gene description: | pantothenate kinase 2 |
Genbank accession: | NM_153638 |
Immunogen: | PANK2 (NP_705902, 205 a.a. ~ 259 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IGDLQLCKLDELDCLIKGILYIDSVGFNGRSQCYYFENPADSEKCQKLPFDLKNP |
Protein accession: | NP_705902 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.16 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to PANK2 on formalin-fixed paraffin-embedded human endometrium tissue. [antibody concentration 1 ~ 10 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |