FLJ21019 polyclonal antibody (A01) View larger

FLJ21019 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FLJ21019 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about FLJ21019 polyclonal antibody (A01)

Brand: Abnova
Reference: H00079990-A01
Product name: FLJ21019 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant FLJ21019.
Gene id: 79990
Gene name: PLEKHH3
Gene alias: FLJ21019
Gene description: pleckstrin homology domain containing, family H (with MyTH4 domain) member 3
Genbank accession: NM_024927
Immunogen: FLJ21019 (NP_079203, 665 a.a. ~ 750 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: DVLELSTEPGRGAPQKLCLGLGAKAMSLSRPGETEPIHSVSYGHVAACQLMGPHTLALRVGESQLLLQSPQVEEIMQLVNAYLANP
Protein accession: NP_079203
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00079990-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.57 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FLJ21019 polyclonal antibody (A01) now

Add to cart