Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GRHL2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about GRHL2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00079977-A01 |
| Product name: | GRHL2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant GRHL2. |
| Gene id: | 79977 |
| Gene name: | GRHL2 |
| Gene alias: | BOM|DFNA28|FLJ11172|FLJ13782|MGC149294|MGC149295|TFCP2L3 |
| Gene description: | grainyhead-like 2 (Drosophila) |
| Genbank accession: | NM_024915 |
| Immunogen: | GRHL2 (NP_079191, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | ENRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRS |
| Protein accession: | NP_079191 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Human Papillomavirus 16 E6 Induces FoxM1B in Oral Keratinocytes through GRHL2.Chen W, Shimane T, Kawano S, Alshaikh A, Kim SY, Chung SH, Kim RH, Shin KH, Walentin K, Park NH, Schmidt-Ott KM, Kang MK. J Dent Res. 2018 Feb 1:22034518756071. |