Brand: | Abnova |
Reference: | H00079949-M07 |
Product name: | C10orf81 monoclonal antibody (M07), clone 3B6 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant C10orf81. |
Clone: | 3B6 |
Isotype: | IgG1 Kappa |
Gene id: | 79949 |
Gene name: | C10orf81 |
Gene alias: | FLJ23537|HEL185|bA211N11.2 |
Gene description: | chromosome 10 open reading frame 81 |
Genbank accession: | BC036365 |
Immunogen: | C10orf81 (AAH36365, 1 a.a. ~ 282 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEQSSPGFRQTHLQDLSEATQDVKEENHYLTPRSVLLELDNIIASSDSGESIETDGPDQVSGRIECHYEPMESYFFKETSHESVDSSKEEPQTLPETQDGDLHLQEQGSGIDWCLSPADVEAQTTNDQKGSASLTVVQLSILINNIPDESQVEKLNVFLSPPDVINYLALTEATGRICVSQWEGPRRLGCIFCHGDHLLAVNDLKPQSLEEVSLFLTRSIQKEKLKLTIGRIPNSETFHAASCMCPSKCQSAAPSQLDKPRLNRAPKRSPAIKKSQQKGARE |
Protein accession: | AAH36365 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (56.76 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | C10orf81 monoclonal antibody (M07), clone 3B6. Western Blot analysis of C10orf81 expression in Jurkat(Cat # L017V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |