ADCK4 monoclonal antibody (M01), clone 1D9 View larger

ADCK4 monoclonal antibody (M01), clone 1D9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADCK4 monoclonal antibody (M01), clone 1D9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about ADCK4 monoclonal antibody (M01), clone 1D9

Brand: Abnova
Reference: H00079934-M01
Product name: ADCK4 monoclonal antibody (M01), clone 1D9
Product description: Mouse monoclonal antibody raised against a partial recombinant ADCK4.
Clone: 1D9
Isotype: IgG2b Kappa
Gene id: 79934
Gene name: ADCK4
Gene alias: FLJ12229
Gene description: aarF domain containing kinase 4
Genbank accession: BC013114
Immunogen: ADCK4 (AAH13114, 445 a.a. ~ 544 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LGEPFATQGPYDFGSGETARRIQDLIPVLLRHRLCPPPEETYALHRKLAGAFLACAHLRAHIACRDLFQDTYHRYWASRQPDAATAGSLPTKGDSWVDPS
Protein accession: AAH13114
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00079934-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00079934-M01-13-15-1.jpg
Application image note: Western Blot analysis of ADCK4 expression in transfected 293T cell line by ADCK4 monoclonal antibody (M01), clone 1D9.

Lane 1: ADCK4 transfected lysate(36.74 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ADCK4 monoclonal antibody (M01), clone 1D9 now

Add to cart