Brand: | Abnova |
Reference: | H00079925-M01A |
Product name: | FLJ23577 monoclonal antibody (M01A), clone 4B10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FLJ23577. |
Clone: | 4B10 |
Isotype: | IgG2a Kappa |
Gene id: | 79925 |
Gene name: | SPEF2 |
Gene alias: | FLJ23164|FLJ23577|FLJ25395|KIAA1770|KPL2|MGC102842 |
Gene description: | sperm flagellar 2 |
Genbank accession: | NM_024867 |
Immunogen: | FLJ23577 (NP_079143, 324 a.a. ~ 422 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQHEERRLKDFQDALDREAALAKQAKIDFEEQFLKEKRFHDQIAVERAQARY |
Protein accession: | NP_079143 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |