FLJ23577 monoclonal antibody (M01), clone 4B10 View larger

FLJ23577 monoclonal antibody (M01), clone 4B10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FLJ23577 monoclonal antibody (M01), clone 4B10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about FLJ23577 monoclonal antibody (M01), clone 4B10

Brand: Abnova
Reference: H00079925-M01
Product name: FLJ23577 monoclonal antibody (M01), clone 4B10
Product description: Mouse monoclonal antibody raised against a partial recombinant FLJ23577.
Clone: 4B10
Isotype: IgG2a Kappa
Gene id: 79925
Gene name: SPEF2
Gene alias: FLJ23164|FLJ23577|FLJ25395|KIAA1770|KPL2|MGC102842
Gene description: sperm flagellar 2
Genbank accession: NM_024867
Immunogen: FLJ23577 (NP_079143, 324 a.a. ~ 422 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQHEERRLKDFQDALDREAALAKQAKIDFEEQFLKEKRFHDQIAVERAQARY
Protein accession: NP_079143
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00079925-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00079925-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to SPEF2 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FLJ23577 monoclonal antibody (M01), clone 4B10 now

Add to cart