Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NANOG monoclonal antibody (M04), clone 3A12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA |
More info about NANOG monoclonal antibody (M04), clone 3A12
| Brand: | Abnova |
| Reference: | H00079923-M04 |
| Product name: | NANOG monoclonal antibody (M04), clone 3A12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NANOG. |
| Clone: | 3A12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 79923 |
| Gene name: | NANOG |
| Gene alias: | - |
| Gene description: | Nanog homeobox |
| Genbank accession: | NM_024865 |
| Immunogen: | NANOG (NP_079141, 98 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPM |
| Protein accession: | NP_079141 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged NANOG is approximately 0.03ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |