Brand: | Abnova |
Reference: | H00079896-M08 |
Product name: | THNSL1 monoclonal antibody (M08), clone 6B1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant THNSL1. |
Clone: | 6B1 |
Isotype: | IgG2a Kappa |
Gene id: | 79896 |
Gene name: | THNSL1 |
Gene alias: | FLJ22002|TSH1 |
Gene description: | threonine synthase-like 1 (S. cerevisiae) |
Genbank accession: | NM_024838 |
Immunogen: | THNSL1 (NP_079114, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IVYLDVPLLDLICRLKLMKTDRIVGQNSGTSMKDLLKFRRQYYKKWYDARVFCESGASPEEVADKVLNAIKRYQDVDSETFISTRHVWPEDCEQKVSAKF |
Protein accession: | NP_079114 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | THNSL1 monoclonal antibody (M08), clone 6B1 Western Blot analysis of THNSL1 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |