C18orf22 purified MaxPab mouse polyclonal antibody (B01P) View larger

C18orf22 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C18orf22 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about C18orf22 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00079863-B01P
Product name: C18orf22 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human C18orf22 protein.
Gene id: 79863
Gene name: C18orf22
Gene alias: FLJ21172|HsT169
Gene description: chromosome 18 open reading frame 22
Genbank accession: BC014195
Immunogen: C18orf22 (AAH14195, 1 a.a. ~ 343 a.a) full-length human protein.
Immunogen sequence/protein sequence: MWAAAGGLWRSRAGLRALFRSRDAALFPGCERGLHCSAVSCKNWLKKFASKTKKKVWYESPSLGSHSTYKPSKLEFLMRSTSKKTRKEDHARLRALNGLLYKALTDLLCTPEVSQELYDLNVELSKVSLTPDFSACRAYWKTTLSAEQNAHMEAVLQRSAAHMRHLLMSQQTLRNVPPIVFVQDKGNAALAELDQLLAVADFGPRDERDNFVQNDFRDPDAPQPCGTTEPTTSSSLCGIDHEALNKQIMEYKRRKDKGLGGLVWQGQVAELTTQMQKGRKRAKPRLEQDSSLKSYLSGEEVEDDLDLVGAPEYECYAPDTEELEAERGGGRTEDGHSCGASRE
Protein accession: AAH14195
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00079863-B01P-13-15-1.jpg
Application image note: Western Blot analysis of C18orf22 expression in transfected 293T cell line (H00079863-T01) by C18orf22 MaxPab polyclonal antibody.

Lane 1: C18orf22 transfected lysate(37.84 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C18orf22 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart