Brand: | Abnova |
Reference: | H00079836-A01 |
Product name: | RNF127 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant RNF127. |
Gene id: | 79836 |
Gene name: | LONRF3 |
Gene alias: | FLJ22612|MGC119463|MGC119465|RNF127 |
Gene description: | LON peptidase N-terminal domain and ring finger 3 |
Genbank accession: | NM_024778 |
Immunogen: | RNF127 (NP_079054, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MESVRIEQMLSLPAEVSSDNLESAERGASAAQVDMGPHPKVAAEGPAPLPTREPEQEQSPGTSTPESKVLLTQADALASRGRIREALEVY |
Protein accession: | NP_079054 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.01 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RNF127 polyclonal antibody (A01), Lot # 051114JC01 Western Blot analysis of LONRF3 expression in SJCRH30 ( Cat # L027V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |