TLE6 purified MaxPab mouse polyclonal antibody (B01P) View larger

TLE6 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TLE6 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about TLE6 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00079816-B01P
Product name: TLE6 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human TLE6 protein.
Gene id: 79816
Gene name: TLE6
Gene alias: FLJ14009|GRG6|MGC14966
Gene description: transducin-like enhancer of split 6 (E(sp1) homolog, Drosophila)
Genbank accession: NM_024760.1
Immunogen: TLE6 (NP_079036.1, 1 a.a. ~ 449 a.a) full-length human protein.
Immunogen sequence/protein sequence: MATRSSDWLRRPLGEDNQPETQLFWDKEPWFWHDTLTEQLWRIFAGVHDEKAKPRDRQQAPGLGQESKAPGSCDPGTDPCPEDASTPRPPEASSSPPEGSQDRNTSWGVVQEPPGRASRFLQSISWDPEDFEDAWKRPDALPGQSKRLAVPCKLEKMRILAHGELVLATAISSFTRHVFTCGRRGIKVWSLTGQVAEDRFPESHLPIQTPGAFLRTCLLSSNSRSLLTGGYNLASVSVWDLAAPSLHVKEQLPCAGLNCQALDANLDANLAFASFTSGVVRIWDLRDQSVVRDLKGYPDGVKSIVVKGYNIWTGGPDACLRCWDQRTIMKPLEYQFKSQIMSLSHSPQEDWVLLGMANGQQWLQSTSGSQRHMVGQKDSVILSVKFSPFGQWWASVGMDDFLGVYSMPAGTKVFEVPEMSPVTCCDVSSNNRLVVTGSGEHASVYQITY
Protein accession: NP_079036.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00079816-B01P-13-15-1.jpg
Application image note: Western Blot analysis of TLE6 expression in transfected 293T cell line (H00079816-T01) by TLE6 MaxPab polyclonal antibody.

Lane 1: TLE6 transfected lysate(49.39 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TLE6 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart