Brand: | Abnova |
Reference: | H00079813-M09 |
Product name: | EHMT1 monoclonal antibody (M09), clone 3C5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EHMT1. |
Clone: | 3C5 |
Isotype: | IgG2a Kappa |
Gene id: | 79813 |
Gene name: | EHMT1 |
Gene alias: | DEL9q34|DKFZp667M072|EUHMTASE1|Eu-HMTase1|FLJ12879|FP13812|GLP|KIAA1876|KMT1D|bA188C12.1 |
Gene description: | euchromatic histone-lysine N-methyltransferase 1 |
Genbank accession: | NM_024757 |
Immunogen: | EHMT1 (NP_079033, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAADEGSAEKQAGEAHMAADGETNGSCENSDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVIGSNGYILNKPA |
Protein accession: | NP_079033 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | EHMT1 monoclonal antibody (M09), clone 3C5. Western Blot analysis of EHMT1 expression in Raw 264.7 |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |