EHMT1 monoclonal antibody (M04), clone 1H2 View larger

EHMT1 monoclonal antibody (M04), clone 1H2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EHMT1 monoclonal antibody (M04), clone 1H2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about EHMT1 monoclonal antibody (M04), clone 1H2

Brand: Abnova
Reference: H00079813-M04
Product name: EHMT1 monoclonal antibody (M04), clone 1H2
Product description: Mouse monoclonal antibody raised against a partial recombinant EHMT1.
Clone: 1H2
Isotype: IgG2a Kappa
Gene id: 79813
Gene name: EHMT1
Gene alias: DEL9q34|DKFZp667M072|EUHMTASE1|Eu-HMTase1|FLJ12879|FP13812|GLP|KIAA1876|KMT1D|bA188C12.1
Gene description: euchromatic histone-lysine N-methyltransferase 1
Genbank accession: NM_024757
Immunogen: EHMT1 (NP_079033, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAADEGSAEKQAGEAHMAADGETNGSCENSDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVIGSNGYILNKPA
Protein accession: NP_079033
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00079813-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00079813-M04-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to EHMT1 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EHMT1 monoclonal antibody (M04), clone 1H2 now

Add to cart