KCTD17 purified MaxPab mouse polyclonal antibody (B01P) View larger

KCTD17 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KCTD17 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about KCTD17 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00079734-B01P
Product name: KCTD17 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human KCTD17 protein.
Gene id: 79734
Gene name: KCTD17
Gene alias: FLJ12242|FLJ98761
Gene description: potassium channel tetramerisation domain containing 17
Genbank accession: NM_024681
Immunogen: KCTD17 (NP_078957.1, 1 a.a. ~ 290 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRMEAGEAAPPAGAGGRAAGGWGKWVRLNVGGTVFLTTRQTLCREQKSFLSRLCQGEELQSDRDETGAYLIDRDPTYFGPILNFLRHGKLVLDKDMAEEGVLEEAEFYNIGPLIRIIKDRMEEKDYTVTQVPPKHVYRVLQCQEEELTQMVSTMSDGWRFEQLVNIGSSYNYGSEDQAEFLCVVSKELHSTPNGLSSESSRKTKSTEEQLEEQQQQEEEVEEVEVEQVQVEADAQEKGSRPHPLRPEAELAVRASPRPLARPQSCHPCCYKPEAPGCEAPDHLQGLGVPI
Protein accession: NP_078957.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00079734-B01P-13-15-1.jpg
Application image note: Western Blot analysis of KCTD17 expression in transfected 293T cell line (H00079734-T01) by KCTD17 MaxPab polyclonal antibody.

Lane 1: KCTD17 transfected lysate(32.50 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy KCTD17 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart