NARS2 purified MaxPab mouse polyclonal antibody (B01P) View larger

NARS2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NARS2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about NARS2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00079731-B01P
Product name: NARS2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human NARS2 protein.
Gene id: 79731
Gene name: NARS2
Gene alias: FLJ23441|SLM5
Gene description: asparaginyl-tRNA synthetase 2, mitochondrial (putative)
Genbank accession: NM_024678
Immunogen: NARS2 (NP_078954, 1 a.a. ~ 477 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLGVRCLLRSVRFCSSAPFPKHKPSAKLSVRDALGAQNASGERIKIQGWIRSVRSQKEVLFLHVNDGSSLESLQVVADSGLDSRELTFGSSVEVQGQLIKSPSKRQNVELKAEKIKVIGNCDAKDFPIKYKERHPLEYLRQYPHFRCRTNVLGSILRIRSEATAAIHSFFKDSGFVHIHTPIITSNDSEGAGELFQLEPSGKLKVPEENFFNVPAFLTVSGQLHLEVMSGAFTQVFTFGPTFRAENSQSRRHLAEFYMIEAEISFVDSLQDLMQVIEELFKATTMMVLSKCPEDVELCHKFIAPGQKDRLEHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGADLRTEHEKYLVKHCGNIPVFVINYPLTLKPFYMRDNEDGPQHTVAAVDLLVPGVGELFGGGLREERYHFLEERLARSGLTEVYQWYLDLRRFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFPHSCLL
Protein accession: NP_078954
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00079731-B01P-13-15-1.jpg
Application image note: Western Blot analysis of NARS2 expression in transfected 293T cell line by NARS2 MaxPab polyclonal antibody.

Lane 1: NARS2 transfected lysate(52.47 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NARS2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart