ZMAT4 monoclonal antibody (M01), clone 7H3-1C11 View larger

ZMAT4 monoclonal antibody (M01), clone 7H3-1C11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZMAT4 monoclonal antibody (M01), clone 7H3-1C11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about ZMAT4 monoclonal antibody (M01), clone 7H3-1C11

Brand: Abnova
Reference: H00079698-M01
Product name: ZMAT4 monoclonal antibody (M01), clone 7H3-1C11
Product description: Mouse monoclonal antibody raised against a full length recombinant ZMAT4.
Clone: 7H3-1C11
Isotype: IgG1 kappa
Gene id: 79698
Gene name: ZMAT4
Gene alias: FLJ13842
Gene description: zinc finger, matrin type 4
Genbank accession: BC019598
Immunogen: ZMAT4 (AAH19598, 1 a.a. ~ 153 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADMVDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTGLRRNYRCAICSVSLNSIEQYHAHLKGSKHQTNLKNK
Protein accession: AAH19598
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00079698-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (42.57 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00079698-M01-13-15-1.jpg
Application image note: Western Blot analysis of ZMAT4 expression in transfected 293T cell line by ZMAT4 monoclonal antibody (M01), clone 7H3-1C11.

Lane 1: ZMAT4 transfected lysate(17 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZMAT4 monoclonal antibody (M01), clone 7H3-1C11 now

Add to cart