Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00079698-M01 |
Product name: | ZMAT4 monoclonal antibody (M01), clone 7H3-1C11 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ZMAT4. |
Clone: | 7H3-1C11 |
Isotype: | IgG1 kappa |
Gene id: | 79698 |
Gene name: | ZMAT4 |
Gene alias: | FLJ13842 |
Gene description: | zinc finger, matrin type 4 |
Genbank accession: | BC019598 |
Immunogen: | ZMAT4 (AAH19598, 1 a.a. ~ 153 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADMVDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTGLRRNYRCAICSVSLNSIEQYHAHLKGSKHQTNLKNK |
Protein accession: | AAH19598 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (42.57 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ZMAT4 expression in transfected 293T cell line by ZMAT4 monoclonal antibody (M01), clone 7H3-1C11. Lane 1: ZMAT4 transfected lysate(17 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |