Cart 97 Product Products 37 898,28 € (empty)
No products
To be determined Shipping
37 898,28 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 97 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 37 898,28 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 37 898,28 €
Data sheet of NS4ATP2 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about NS4ATP2 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00079685-B01P |
| Product name: | NS4ATP2 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human NS4ATP2 protein. |
| Gene id: | 79685 |
| Gene name: | SAP30L |
| Gene alias: | DKFZp667L2214|FLJ11526|FLJ23595|FLJ36497|NS4ATP2 |
| Gene description: | SAP30-like |
| Genbank accession: | NM_024632.3 |
| Immunogen: | NS4ATP2 (NP_078908.1, 1 a.a. ~ 183 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MNGFSTEEDSREGPPAAPAAAAPGYGQSCCLIEDGERCVRPAGNASFSKRVQKSISQKKLKLDIDKSVRHLYICDFHKNFIQSVRNKRKRKTSDDGGDSPEHDTDIPEVDLFQLQVNTLRRYKRHYKLQTRPGFNKAQLAETVSRHFRNIPVNEKETLAYFIYMVKSNKSRLDQKSEGGKQLE |
| Protein accession: | NP_078908.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SAP30L expression in transfected 293T cell line (H00079685-T01) by SAP30L MaxPab polyclonal antibody. Lane 1: NS4ATP2 transfected lysate(20.13 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |