FLJ21901 polyclonal antibody (A01) View larger

FLJ21901 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FLJ21901 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about FLJ21901 polyclonal antibody (A01)

Brand: Abnova
Reference: H00079675-A01
Product name: FLJ21901 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant FLJ21901.
Gene id: 79675
Gene name: FASTKD1
Gene alias: FLJ21901|KIAA1800
Gene description: FAST kinase domains 1
Genbank accession: NM_024622
Immunogen: FLJ21901 (NP_078898, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: KKTPVFLESLVTNMLRLRAICPFSWRVFQFRPISCEPLIIQMNKCTDEEQMFGFIERNKAILSEKQVGCAFDMLWKLQKQKTSLLKNAEYVRDHPQFL
Protein accession: NP_078898
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00079675-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.89 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00079675-A01-1-6-1.jpg
Application image note: FLJ21901 polyclonal antibody (A01), Lot # 060614JCS1 Western Blot analysis of FLJ21901 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FLJ21901 polyclonal antibody (A01) now

Add to cart