Cart 95 Product Products 37 380,14 € (empty)
No products
To be determined Shipping
37 380,14 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 95 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 37 380,14 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 37 380,14 €
Data sheet of PPP1R3B purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ti,IF,WB-Tr |
More info about PPP1R3B purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00079660-B01P |
| Product name: | PPP1R3B purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human PPP1R3B protein. |
| Gene id: | 79660 |
| Gene name: | PPP1R3B |
| Gene alias: | FLJ14005|FLJ34675|GL|PPP1R4 |
| Gene description: | protein phosphatase 1, regulatory (inhibitor) subunit 3B |
| Genbank accession: | BC043388.1 |
| Immunogen: | PPP1R3B (AAH43388.1, 1 a.a. ~ 285 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY |
| Protein accession: | AAH43388.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | PPP1R3B MaxPab polyclonal antibody. Western Blot analysis of PPP1R3B expression in rat brain. |
| Applications: | WB-Ti,IF,WB-Tr |
| Shipping condition: | Dry Ice |