No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ti,IF,WB-Tr |
Brand: | Abnova |
Reference: | H00079660-B01P |
Product name: | PPP1R3B purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human PPP1R3B protein. |
Gene id: | 79660 |
Gene name: | PPP1R3B |
Gene alias: | FLJ14005|FLJ34675|GL|PPP1R4 |
Gene description: | protein phosphatase 1, regulatory (inhibitor) subunit 3B |
Genbank accession: | BC043388.1 |
Immunogen: | PPP1R3B (AAH43388.1, 1 a.a. ~ 285 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY |
Protein accession: | AAH43388.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | PPP1R3B MaxPab polyclonal antibody. Western Blot analysis of PPP1R3B expression in rat brain. |
Applications: | WB-Ti,IF,WB-Tr |
Shipping condition: | Dry Ice |