FLJ13154 purified MaxPab mouse polyclonal antibody (B01P) View larger

FLJ13154 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FLJ13154 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about FLJ13154 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00079650-B01P
Product name: FLJ13154 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human FLJ13154 protein.
Gene id: 79650
Gene name: C16orf57
Gene alias: FLJ13154|HVSL1
Gene description: chromosome 16 open reading frame 57
Genbank accession: BC004415
Immunogen: FLJ13154 (AAH04415, 1 a.a. ~ 265 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSAAPLVGYSSSGSEDESEDGMRTRPGDGSHRRGQSPLPRQRFPVPDSVLNMFPGTEEGPEDDSTKHGGRVRTFPHERGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYVPRLVRMKVFHLSLSQSVVLRHHWILPFVQALKARMTSFHRFFFTANQVKIYTNQEKTRTFIGLEVTSGHAQFLDLVSEVDRVMEEFNLTTFYQDPSFHLSLAWCVGDARLQLEGQCLQELQAIVDGSEDAEVLLRVHTEQVRCKSGNKFFSMPLK
Protein accession: AAH04415
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00079650-B01P-13-15-1.jpg
Application image note: Western Blot analysis of C16orf57 expression in transfected 293T cell line (H00079650-T01) by C16orf57 MaxPab polyclonal antibody.

Lane 1: FLJ13154 transfected lysate(29.26 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FLJ13154 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart