Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00079626-B01P |
Product name: | TNFAIP8L2 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human TNFAIP8L2 protein. |
Gene id: | 79626 |
Gene name: | TNFAIP8L2 |
Gene alias: | FLJ23467|TIPE2 |
Gene description: | tumor necrosis factor, alpha-induced protein 8-like 2 |
Genbank accession: | BC063014 |
Immunogen: | TNFAIP8L2 (AAH63014, 1 a.a. ~ 184 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL |
Protein accession: | AAH63014 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of TNFAIP8L2 expression in transfected 293T cell line (H00079626-T01) by TNFAIP8L2 MaxPab polyclonal antibody. Lane 1: TNFAIP8L2 transfected lysate(20.24 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Nicotine induces TIPE2 upregulation and Stat3 phosphorylation contributes to cholinergic anti-inflammatory effect.Sui HX, Ke SZ, Xu DD, Lu NN, Wang YN, Zhang YH, Gao FG. Int J Oncol. 2017 Sep;51(3):987-995. doi: 10.3892/ijo.2017.4080. Epub 2017 Jul 27. |