RIC3 purified MaxPab mouse polyclonal antibody (B01P) View larger

RIC3 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RIC3 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about RIC3 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00079608-B01P
Product name: RIC3 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human RIC3 protein.
Gene id: 79608
Gene name: RIC3
Gene alias: AYST720|FLJ11608|PRO1385
Gene description: resistance to inhibitors of cholinesterase 3 homolog (C. elegans)
Genbank accession: NM_024557
Immunogen: RIC3 (NP_078833.2, 1 a.a. ~ 368 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAYSTVQRVALASGLVLALSLLLPKAFLSRGKRQEPPPTPEGKLGRFPPMMHHHQAHSDGQTPGARFQRSHLAEAFAKAKGSGGGAGGGGSGRGLMGQIIPIYGFGIFLYILYILFKLSKGKTTAEDGKCYTAMPGNTHRKITSFELAQLQEKLKETEAAMEKLFNRVGPNGERAQTVTSDQEKRLLHQLREITRVMKEGKFIDRFSPEKEAEEAPYMEDWEGYPEETYPIYDLSDCIKRRQETILVDYPDPKELSAEEIAERMGMIEEEESDHLGWESLPTDPRAQEDNSVTSCDPKPETCSCCFHEDEDPAVLAENAGFSADSYPEQEETTKEEWSQDFKDEGLGISTDKAYTGSMLRKRNPQGLE
Protein accession: NP_078833.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00079608-B01P-13-15-1.jpg
Application image note: Western Blot analysis of RIC3 expression in transfected 293T cell line (H00079608-T01) by RIC3 MaxPab polyclonal antibody.

Lane 1: RIC3 transfected lysate(40.48 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RIC3 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart