Cart 141 Product Products 66 742,00 € (empty)
No products
To be determined Shipping
66 742,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 141 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 66 742,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 66 742,00 €
Data sheet of ADIPOR2 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about ADIPOR2 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00079602-D01P |
| Product name: | ADIPOR2 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human ADIPOR2 protein. |
| Gene id: | 79602 |
| Gene name: | ADIPOR2 |
| Gene alias: | ACDCR2|FLJ21432|MGC4640|PAQR2 |
| Gene description: | adiponectin receptor 2 |
| Genbank accession: | NM_024551 |
| Immunogen: | ADIPOR2 (NP_078827.2, 1 a.a. ~ 386 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFMIGGGCSEEDAL |
| Protein accession: | NP_078827.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ADIPOR2 expression in transfected 293T cell line (H00079602-T02) by ADIPOR2 MaxPab polyclonal antibody. Lane 1: ADIPOR2 transfected lysate(43.90 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |