MRPL24 (Human) Recombinant Protein (P01) View larger

MRPL24 (Human) Recombinant Protein (P01)

New product

279,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MRPL24 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about MRPL24 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00079590-P01
Product name: MRPL24 (Human) Recombinant Protein (P01)
Product description: Human MRPL24 full-length ORF ( NP_078816.2, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 79590
Gene name: MRPL24
Gene alias: FLJ20917|L24mt|MGC22737|MGC9831|MRP-L18|MRP-L24
Gene description: mitochondrial ribosomal protein L24
Genbank accession: NM_024540.2
Immunogen sequence/protein sequence: MRLSALLALASKVTLPPHYRYGMSPPGSVADKRKNPPWIRRRPVVVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVGGLNTHYRYIGKTMDYRGTMIPSEAPLLHRQVKLVDPMDRKPTEIEWRFTEAGERVRVSTRSGRIIPKPEFPRADGIVPETWIDGPKDTSVEDALERTYVPCLKTLQEEVMEAMGIKETRKYKKVYWY
Protein accession: NP_078816.2
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00079590-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MRPL24 (Human) Recombinant Protein (P01) now

Add to cart