SPAG16 monoclonal antibody (M01), clone 1D2 View larger

SPAG16 monoclonal antibody (M01), clone 1D2

H00079582-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPAG16 monoclonal antibody (M01), clone 1D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ti,S-ELISA,ELISA,WB-Re

More info about SPAG16 monoclonal antibody (M01), clone 1D2

Brand: Abnova
Reference: H00079582-M01
Product name: SPAG16 monoclonal antibody (M01), clone 1D2
Product description: Mouse monoclonal antibody raised against a full-length recombinant SPAG16.
Clone: 1D2
Isotype: IgG1 Kappa
Gene id: 79582
Gene name: SPAG16
Gene alias: DKFZp666P1710|FLJ22724|FLJ37717|MGC87036|PF20|WDR29
Gene description: sperm associated antigen 16
Genbank accession: NM_001025436.1
Immunogen: SPAG16 (NP_001020607.1, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYVIF
Protein accession: NP_001020607.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00079582-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (47 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00079582-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged SPAG16 is 0.1 ng/ml as a capture antibody.
Applications: WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SPAG16 monoclonal antibody (M01), clone 1D2 now

Add to cart