Cart 78 Product Products 36 690,00 € (empty)
No products
To be determined Shipping
36 690,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 78 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 36 690,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 36 690,00 €
Data sheet of C2orf47 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
More info about C2orf47 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00079568-D01P |
| Product name: | C2orf47 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human C2orf47 protein. |
| Gene id: | 79568 |
| Gene name: | C2orf47 |
| Gene alias: | DKFZp666A212|FLJ22555 |
| Gene description: | chromosome 2 open reading frame 47 |
| Genbank accession: | BC017959.1 |
| Immunogen: | C2orf47 (AAH17959.1, 1 a.a. ~ 291 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MALAARLQPQFLHSRSLPCGAVRLRTPAVAEVRLPSATLCYFCRCRLGLGAALFPRSARALAASALPAQGSRWPVLSSPGLPAAFTSFPACPQRSYSTEEKPQQHQKTKMIVLGFSNPINWVRTRIKAFLIWAYFDKEFSITEFSEGAKQAFAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKSALAANIDEIVFTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSETLRGASVFQVKLGNQNVETNQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE |
| Protein accession: | AAH17959.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of C2orf47 expression in transfected 293T cell line (H00079568-T02) by C2orf47 MaxPab polyclonal antibody. Lane 1: C2orf47 transfected lysate(32.12 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |