BCL2L14 purified MaxPab rabbit polyclonal antibody (D01P) View larger

BCL2L14 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BCL2L14 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about BCL2L14 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00079370-D01P
Product name: BCL2L14 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human BCL2L14 protein.
Gene id: 79370
Gene name: BCL2L14
Gene alias: BCLG
Gene description: BCL2-like 14 (apoptosis facilitator)
Genbank accession: NM_138722
Immunogen: BCL2L14 (NP_620048.1, 1 a.a. ~ 327 a.a) full-length human protein.
Immunogen sequence/protein sequence: MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD
Protein accession: NP_620048.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00079370-D01P-13-15-1.jpg
Application image note: Western Blot analysis of BCL2L14 expression in transfected 293T cell line (H00079370-T02) by BCL2L14 MaxPab polyclonal antibody.

Lane 1: BCL2L14 transfected lysate(36.60 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy BCL2L14 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart