BCL2L14 MaxPab mouse polyclonal antibody (B01) View larger

BCL2L14 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BCL2L14 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about BCL2L14 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00079370-B01
Product name: BCL2L14 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human BCL2L14 protein.
Gene id: 79370
Gene name: BCL2L14
Gene alias: BCLG
Gene description: BCL2-like 14 (apoptosis facilitator)
Genbank accession: NM_138722
Immunogen: BCL2L14 (NP_620048, 1 a.a. ~ 327 a.a) full-length human protein.
Immunogen sequence/protein sequence: MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD
Protein accession: NP_620048
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00079370-B01-13-15-1.jpg
Application image note: Western Blot analysis of BCL2L14 expression in transfected 293T cell line (H00079370-T01) by BCL2L14 MaxPab polyclonal antibody.

Lane 1: BCL2L14 transfected lysate(35.97 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy BCL2L14 MaxPab mouse polyclonal antibody (B01) now

Add to cart