IRX1 monoclonal antibody (M04), clone 1A11 View larger

IRX1 monoclonal antibody (M04), clone 1A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IRX1 monoclonal antibody (M04), clone 1A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about IRX1 monoclonal antibody (M04), clone 1A11

Brand: Abnova
Reference: H00079192-M04
Product name: IRX1 monoclonal antibody (M04), clone 1A11
Product description: Mouse monoclonal antibody raised against a partial recombinant IRX1.
Clone: 1A11
Isotype: IgG2a Kappa
Gene id: 79192
Gene name: IRX1
Gene alias: IRX-5|IRXA1
Gene description: iroquois homeobox 1
Genbank accession: NM_024337
Immunogen: IRX1 (NP_077313, 424 a.a. ~ 479 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NGDKASVRSSPTLPERDLVPRPDSPAQQLKSPFQPVRDNSLAPQEGTPRILAALPS
Protein accession: NP_077313
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00079192-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.9 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00079192-M04-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged IRX1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IRX1 monoclonal antibody (M04), clone 1A11 now

Add to cart