IRX3 monoclonal antibody (M03), clone 3D8 View larger

IRX3 monoclonal antibody (M03), clone 3D8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IRX3 monoclonal antibody (M03), clone 3D8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about IRX3 monoclonal antibody (M03), clone 3D8

Brand: Abnova
Reference: H00079191-M03
Product name: IRX3 monoclonal antibody (M03), clone 3D8
Product description: Mouse monoclonal antibody raised against a partial recombinant IRX3.
Clone: 3D8
Isotype: IgG2a Kappa
Gene id: 79191
Gene name: IRX3
Gene alias: IRX-1
Gene description: iroquois homeobox 3
Genbank accession: NM_024336
Immunogen: IRX3 (NP_077312, 182 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RRRLKKENKMTWAPRSRTDEEGNAYGSEREEEDEEEDEEDCKRELELEEEELGGEEEDTGGEGLADDDEDEEIDLENLDGAATEPELSLAGAARRDGDLGLGPI
Protein accession: NP_077312
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00079191-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.18 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00079191-M03-1-9-1.jpg
Application image note: IRX3 monoclonal antibody (M03), clone 3D8 Western Blot analysis of IRX3 expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IRX3 monoclonal antibody (M03), clone 3D8 now

Add to cart