Brand: | Abnova |
Reference: | H00079174-A01 |
Product name: | CRELD2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant CRELD2. |
Gene id: | 79174 |
Gene name: | CRELD2 |
Gene alias: | DKFZp667O055|MGC11256 |
Gene description: | cysteine-rich with EGF-like domains 2 |
Genbank accession: | NM_024324 |
Immunogen: | CRELD2 (NP_077300, 162 a.a. ~ 258 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | GDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVGWVLDEGACVDVDECAAEPPPCSAAQFCKNANGSYTCEE |
Protein accession: | NP_077300 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.78 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CRELD2 polyclonal antibody (A01), Lot # 060509JCS1 Western Blot analysis of CRELD2 expression in Y-79 ( Cat # L042V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |