CARD14 (Human) Recombinant Protein (Q02) View larger

CARD14 (Human) Recombinant Protein (Q02)

H00079092-Q02_10ug

New product

374,00 € tax excl.

10 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CARD14 (Human) Recombinant Protein (Q02)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about CARD14 (Human) Recombinant Protein (Q02)

Brand: Abnova
Reference: H00079092-Q02
Product name: CARD14 (Human) Recombinant Protein (Q02)
Product description: Human CARD14 partial ORF ( NP_077015, 905 a.a. - 1004 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 79092
Gene name: CARD14
Gene alias: BIMP2|CARMA2
Gene description: caspase recruitment domain family, member 14
Genbank accession: NM_024110
Immunogen sequence/protein sequence: VQLDSVCTLHRMDIFPIVIHVSVNEKMAKKLKKGLQRLGTSEEQLLEAARQEEGDLDRAPCLYSSLAPDGWSDLDGLLSCVRQAIADEQKKVVWTEQSPR
Protein accession: NP_077015
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00079092-Q02-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CARD14 (Human) Recombinant Protein (Q02) now

Add to cart